PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cucsa.042330.2
Common NameCsa_3G061560
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family WRKY
Protein Properties Length: 462aa    MW: 51182.6 Da    PI: 6.6562
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cucsa.042330.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY100.41.1e-31138195260
                     --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
            WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 
                     dDgynWrKYGqK+vkgsefprsYY+Ct+++C+vkk  ers+ d+++++i+Y+g+H+h+k
  Cucsa.042330.2 138 DDGYNWRKYGQKHVKGSEFPRSYYKCTHPNCEVKKLFERSH-DGQITDIIYKGTHDHPK 195
                     8****************************************.***************85 PP

2WRKY105.62.5e-33313371159
                     ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
            WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                     ldDgy+WrKYGqK+v+g+++prsYY+Ct  gCpv+k+ver+++dpk+v++tYeg+Hnh+
  Cucsa.042330.2 313 LDDGYRWRKYGQKVVRGNPNPRSYYKCTNVGCPVRKHVERASHDPKAVITTYEGKHNHD 371
                     59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5081123.376132196IPR003657WRKY domain
Gene3DG3DSA:2.20.25.802.3E-27133196IPR003657WRKY domain
SuperFamilySSF1182905.75E-25134196IPR003657WRKY domain
SMARTSM007741.0E-33137195IPR003657WRKY domain
PfamPF031061.9E-24138194IPR003657WRKY domain
Gene3DG3DSA:2.20.25.801.9E-37298373IPR003657WRKY domain
SuperFamilySSF1182902.09E-29305373IPR003657WRKY domain
PROSITE profilePS5081138.549308373IPR003657WRKY domain
SMARTSM007745.3E-39313372IPR003657WRKY domain
PfamPF031066.9E-26314371IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009611Biological Processresponse to wounding
GO:0009961Biological Processresponse to 1-aminocyclopropane-1-carboxylic acid
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 462 aa     Download sequence    Send to blast
MAHDSSGSAI YPMTSMAFSN TNASDEGRSN YFEFKPYVGP NMVPADLSHR KGEQFSEVQG  60
QPQPFTAPPM TKMEISVMSN DLSRSTQMDT HTVASGVSVP EANGDEINHS LNTNSRVQAP  120
QSDPKGSGIP VVSDRLSDDG YNWRKYGQKH VKGSEFPRSY YKCTHPNCEV KKLFERSHDG  180
QITDIIYKGT HDHPKPQPSR RYSASASMNV QEDGTDKPSS LPGQDDRSCS MYAQTMHTIE  240
PNGTTDPSMP ANDRITEGAG TTLPCKNHDE VDDDDIYLKR RKMELGGFDV CPMVKPIREP  300
RVVVQTLSEV DILDDGYRWR KYGQKVVRGN PNPRSYYKCT NVGCPVRKHV ERASHDPKAV  360
ITTYEGKHNH DVPTAKTSSH DVTGPSTIPS SRYRLEESDT ISLDLGVGIG TGGENRSNEY  420
RQALHSQLVE NRAPSGNFNF EVVQENSAPT YFGVLNRSVI N*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2lex_A8e-37127373677Probable WRKY transcription factor 4
1wj2_A8e-37127373677Probable WRKY transcription factor 4
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00455DAPTransfer from AT4G26640Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankGU9840170.0GU984017.1 Cucumis sativus WRKY protein (WRKY17) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001275533.10.0probable WRKY transcription factor 20-like
SwissprotQ93WV01e-139WRK20_ARATH; Probable WRKY transcription factor 20
TrEMBLA0A0A0L2V10.0A0A0A0L2V1_CUCSA; Uncharacterized protein
STRINGGLYMA02G46690.10.0(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G26640.11e-141WRKY family protein
Publications ? help Back to Top
  1. Ren Y, et al.
    An integrated genetic and cytogenetic map of the cucumber genome.
    PLoS ONE, 2009. 4(6): p. e5795
    [PMID:19495411]
  2. Guo S, et al.
    Transcriptome sequencing and comparative analysis of cucumber flowers with different sex types.
    BMC Genomics, 2010. 11: p. 384
    [PMID:20565788]
  3. Li Z, et al.
    RNA-Seq improves annotation of protein-coding genes in the cucumber genome.
    BMC Genomics, 2011. 12: p. 540
    [PMID:22047402]